Vpf-1 precursor(486) Protein Card

General Information
Name Vpf-1 precursor
Sequence
AAFALPA
FASFEKDVITRAALEAVLNRKAPLSNIMMENDA
IVNVIANVKTVISN
PVLEEALFKTNHGVN
GIPCGESCVFI
PCLTAAIGCSCRSKVCYRN
SLGN
Class Cyclotide
Average Mass 10928.76
Monoisotopic Mass 10921.57
m/z M+H 10922.58
ProteinType Precursor
Parent
Organism Viola pinetorum
Notes
Cyclic No

Assay
No assays found

References

Cross-references
Domains Vpf-1 (503)
Nucleic acids
Structure
Links

Tools