Vpl-1 precursor(485) Protein Card

General Information
Name Vpl-1 precursor
Sequence
AAFALPALA
TGFDKDFITHETVQAILKKVGSNSNGMLDEE
AINALTSKTIISN
PVLEEALLKHSNSING
GSQSCGESCVL
IPCISGVIGCSCSSMICYFN
SLA
Class Cyclotide
Average Mass 10683.24
Monoisotopic Mass 10676.25
m/z M+H 10677.26
ProteinType Precursor
Parent
Organism Viola pinetorum
Notes
Cyclic No

Assay
No assays found

References

Cross-references
Domains Vpl-1 (502)
Nucleic acids
Structure
Links

Tools