Vaf-1(484) Protein Card

General Information
Name Vaf-1
Sequence
AAFALPALA
TSFEKDFITHETVQEILKKVGSNSNGMLDEQ
TISAFTGKTIISN
PLLEEALFKHSNNINALG
GTLPCGESC
VWIPCISSVVGCSCKSKVCYKN
SLA
Class Cyclotide
Average Mass 11153.84
Monoisotopic Mass 11146.58
m/z M+H 11147.59
ProteinType Precursor
Parent
Organism Viola adunca
Notes
Cyclic No

Assay
No assays found

References

Cross-references
Domains cycloviolacin O8 (27)
Nucleic acids
Structure
Links

Tools