Val-1(483) Protein Card

General Information
Name Val-1
Sequence
AAFALPALA
TSFEKDFITHETVQAILKKVGPNSNGILDEQ
TISALTGKTIISN
PVLEEALFKHSNSINALG
GTLPCGESC
VWIPCISSVVGCSCKSKVCYKN
SLA
Class Cyclotide
Average Mass 10994.72
Monoisotopic Mass 10987.61
m/z M+H 10988.62
ProteinType Precursor
Parent
Organism Viola adunca
Notes
Cyclic Yes

Assay
No assays found

References

Cross-references
Domains cycloviolacin O8 (27)
Nucleic acids
Structure
Links

Tools