Hyfl I precursor(481) Protein Card

General Information
Name Hyfl I precursor
Sequence
AAFALPAIA
TLEKDVITPETIQAVLKKTGSPLSNIMLEED
VINAMVKSKTVISK
TVLDEALLKHDGLG
GIPCGESCVFIP
CISGVIGCSCKSKVCYRN
SLIN
Class Cyclotide
Average Mass 10735.71
Monoisotopic Mass 10728.63
m/z M+H 10729.64
ProteinType Precursor
Parent
Organism Hybanthus floribundus W
Notes
Cyclic No

Assay
No assays found

References

Cross-references
Domains Hyfl I (149)
Nucleic acids
Structure
Links

Tools