Cter B(478) Protein Card

General Information
Name Cter B
Sequence GVPCAESCVWIPCTVTALLGCSCKDKVCYLN
Class Cyclotide
Technique MS,PcR
Average Mass 3252.86
Monoisotopic Mass 3250.45
m/z M+H 3252.86
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes High general expression in C. ternatea. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ (2011) Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins. ACS Chem Biol 6:345-355
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter B precursor
Nucleic acids
Structure
Links SwissProt P86842

Tools