Cter A(477) Protein Card

General Information
Name Cter A
Sequence GVIPCGESCVFIPCISTVIGCSCKNKVCYRN
Class Cyclotide
Technique MS,PcR
Average Mass 3269.89
Monoisotopic Mass 3267.48
m/z M+H 3269.89
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes May also exist as a mature linear peptide. Observed PTM: methylation T17. (Serra et al., 2016) High general expression in C. ternatea. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ (2011) Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins. ACS Chem Biol 6:345-355
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter A or Cter Q precursor [partial]
Cter A precursor
Nucleic acids
Structure
Links SwissProt P86841

Tools