Viba 13(447) Protein Card

General Information
Name Viba 13
Alternative name(s) cycloviolacin B16
Sequence TIPCAESCVWIPCTVTALLGCSCKDKVCYN
Class Cyclotide
Technique PcR,MS
Average Mass 3197.78
Monoisotopic Mass 3195.4
m/z M+H 3197.78
ProteinType Wild type
Parent
Organism Viola odorata
Viola baoshanensis
Notes predicted from precursor. Aslam et al. (2021) was able to isolate viba 13 from V. odorata leaf tissue.
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) cyclotide precursor 4c
Nucleic acids cyclotide precursor 4c mRNA
Structure
Links SwissProt B5B3Z1

3D models Download or view with Jmol

Tools