cyclotide precursor 4c(446) Protein Card

General Information
Name cyclotide precursor 4c
Sequence
MESNKKMQLVGFVLLAAFALPALAS
SFEKDVISPRAIQAV
LEKRGLSKLEDDPVLSALARTKTIISN
PVIEEALLNGANL
KAGN
TIPCAESCVWIPCTVTALLGCSCKDKVCYN
SLQTKY

Class Cyclotide
Average Mass 12872.15
Monoisotopic Mass 12863.76
m/z M+H 12864.77
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains Viba 13 (447)
Nucleic acids cyclotide precursor 4c mRNA
Structure
Links GenBank ACG69855.1

Tools