cyclotide precursor 4b(445) Protein Card

General Information
Name cyclotide precursor 4b
Sequence
MESNKKMQLIGFVLLAAFALPALAS
SFEKDVISPHAIQAV
LEKRGFSKLEDDPVVSALARTKTIISN
PVIEEALLNGTNL
KAGN
GIPCAESCVWIPCTVTALVGCSCSDKVCYN
SLQTKY

Class Cyclotide
Average Mass 12817.97
Monoisotopic Mass 12809.61
m/z M+H 12810.61
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains cycloviolacin Y5 (351)
Nucleic acids cyclotide precursor 4b mRNA
Structure
Links GenBank ACG69854.1

Tools