cyclotide precursor 4a(444) Protein Card

General Information
Name cyclotide precursor 4a
Sequence
MESNKKMQLVGFVLLAAFALPALAS
SFEKDVISPRAIQAV
LEKRGLSKLEDDPVLSALARTKTIISN
PVIEEALLNGANL
KAGN
GIPCAESCVWIPCTVTALLGCSCKDKVCYN
SLQTKY

Class Cyclotide
Average Mass 12828.10
Monoisotopic Mass 12819.73
m/z M+H 12820.74
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains Viba 12 (378)
Nucleic acids cyclotide precursor 4a mRNA
Structure
Links GenBank ACG69853.1

Tools