cyclotide precursor 3d(442) Protein Card

General Information
Name cyclotide precursor 3d
Sequence
MDAKKMFVALVLVATFVLPSLAT
FEKDFITPETIQAILKK
SAPLSNIMLEEDVINALLKSKTVISN
PIIEEAFLKNSNGL
N
GIPCGESCVWIPCISGAIGCSCKSKVCYRN
SLDN
Class Cyclotide
Average Mass 12438.70
Monoisotopic Mass 12430.45
m/z M+H 12431.46
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains Viba 11 (443)
Nucleic acids cyclotide precursor 3d mRNA
Structure
Links GenBank ACG69852.1

Tools