viba 11 precursor(442) Protein Card

General Information
Name viba 11 precursor
Alternative name(s) cyclotide precursor 3d
Sequence
MDAKKMFVALVLVATFVLPSLAT
FEKDFITPETIQAILKK
SAPLSNIMLEEDVINALLKSKTVISN
PIIEEAFLKNSNGL
N
GIPCGESCVWIPCISGAIGCSCKSKVCYRN
SLDN
Class Cyclotide
Technique PcR,NGS
ProteinType Precursor
Parent
Organism Viola baoshanensis
Viola betonicifolia
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32
Rajendran,S., Slazak,B., Mohotti,S., Strömstedt,A.A., Göransson,U., Hettiarachchi,C.M. and Gunasekera,S. (2021) Tropical vibes from Sri Lanka - cyclotides from Viola betonicifolia by transcriptome and mass spectrometry analysis. Phytochemistry 187:112749-0

Cross-references
Domains Viba 11 (443)
Nucleic acids viba 11 precursor
viba 11 precursor
Structure
Links GenBank ACG69852.1

Tools