Viba 9(440) Protein Card

General Information
Name Viba 9
Alternative name(s) cycloviolacin B14
Sequence GIPCGESCVWIPCISSAIGCSCKNKVCYRK
Class Cyclotide
Technique MS
Average Mass 3181.79
Monoisotopic Mass 3179.43
m/z M+H 3181.79
ProteinType Wild type
Parent
Organism Viola tricolor
Viola baoshanensis
Notes predicted from precursor could be linear
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Protein precursor(s) cyclotide precursor 3b
Nucleic acids cyclotide precursor 3b mRNA
Structure
Links SwissProt B5B3Y6

3D models Download or view with Jmol

Tools