Viba 8(439) Protein Card

General Information
Name Viba 8
Alternative name(s) cycloviolacin B13
Sequence GAGCIETCYTFPCISEMINCSCKNSRCQKN
Class Cyclotide
Average Mass 3280.76
Monoisotopic Mass 3278.32
m/z M+H 3279.33
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes Zhang et al 2009 published a different sequence in Table 2 (position 26 R>V) but the sequence in their Figure 1 and in GenBank (see cDNA sequence) confirm the sequence in the present card.
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Protein precursor(s) cyclotide precursor 3a
Nucleic acids cyclotide precursor 3a mRNA
Structure
Links SwissProt B5B3Y5

3D models Download or view with Jmol

Tools