cyclotide precursor 3b(438) Protein Card

General Information
Name cyclotide precursor 3b
Sequence
MDAKKMFLALVLIATFAVIPSLAT
FEKDFITREAIQAILK
KSAPLSNIMLEEDVMNALIKSKSVISN
PVIEEALLKNNNG
LN
GIPCGESCVWIPCISSAIGCSCKNKVCYRK
SLDI
Class Cyclotide
Average Mass 12620.04
Monoisotopic Mass 12611.63
m/z M+H 12612.63
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains Viba 9 (440)
Nucleic acids cyclotide precursor 3b mRNA
Structure
Links GenBank ACG69850.1

Tools