Viba 7(436) Protein Card

General Information
Name Viba 7
Alternative name(s) cycloviolacin B12
Sequence GVIPCGESCVFIPCISSVIGCSCKSKVCYRN
Class Cyclotide
Average Mass 3228.84
Monoisotopic Mass 3226.46
m/z M+H 3227.46
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Protein precursor(s) cyclotide precursor 2e
Nucleic acids cyclotide precursor 2e mRNA
Structure
Links SwissProt B5B3Y4

3D models Download or view with Jmol

Tools