cyclotide precursor 2e(435) Protein Card

General Information
Name cyclotide precursor 2e
Sequence
MDSKIVFVALVLIATFALPSLAT
FEKDFITTETVRAILKK
TNSNTMPSEDAINALTGKTLISS
VVLDEALLKNLDNGLN
G
VIPCGESCVFIPCISSVIGCSCKSKVCYRN
SLDM
Class Cyclotide
Average Mass 12193.33
Monoisotopic Mass 12185.29
m/z M+H 12186.29
ProteinType Precursor
Parent
Organism Viola baoshanensis
Notes
Cyclic No

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Domains Viba 7 (436)
Nucleic acids cyclotide precursor 2e mRNA
Structure
Links GenBank ACG69848.1

Tools