Viba 4(430) Protein Card

General Information
Name Viba 4
Alternative name(s) cycloviolacin B10
Sequence GVPCGESCVWIPCLTSAIGCSCKSSVCYRN
Class Cyclotide
Average Mass 3099.60
Monoisotopic Mass 3097.3
m/z M+H 3098.31
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Protein precursor(s) cyclotide precursor 2a
Nucleic acids cyclotide precursor 2a mRNA
Structure
Links SwissProt B5B3Y0

3D models Download or view with Jmol

Tools