Viba 3(428) Protein Card

General Information
Name Viba 3
Alternative name(s) cycloviolacin B9
Sequence GIPCGESCVWIPCLTAAIGCSCSSKVCYRN
Class Cyclotide
Average Mass 3097.62
Monoisotopic Mass 3095.33
m/z M+H 3096.33
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Protein precursor(s) cyclotide precursor 2d
cyclotide precursor 1c
Nucleic acids cyclotide precursor 1c mRNA
cyclotide precursor 2d mRNA
Structure
Links SwissProt B5B3Y3

3D models Download or view with Jmol

Tools