Vbc6 precursor protein (partial)(423) Protein Card

General Information
Name Vbc6 precursor protein (partial)
Sequence
AAFALPAFAS
FEKDVITPAALEAVLNRKAPLSNIMMENDA
IVNVIANVKTVISN
PVLEEALLKTNHGVN
GIPCGESCVWI
PCITSAIGCSCKSKVCYRN
SLDN
Class Cyclotide
Average Mass 10920.73
Monoisotopic Mass 10913.55
m/z M+H 10914.55
ProteinType Precursor
Parent
Organism Viola biflora
Notes
Cyclic No

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Domains vitri A (36)
Nucleic acids Vbc6 mRNA, partial cds
Structure
Links GenBank ABW08095.1

Tools