Vbc5 precursor protein (partial)(422) Protein Card

General Information
Name Vbc5 precursor protein (partial)
Sequence
AAFALPAFAS
FEKDVITPAALEAVLNRKAPLYNIMMENDA
ILNVIANVKTVISN
PVLEEALLKTNHGVN
GIPCGESCVWI
PCLTSAVGCSCKSKVCYRN
SLDNAAFALPAFASFEKDVIT
PAALEAVLNRKAPLYNIMMENDAILNVIANVKTVISN
PVL
EEALLKTNHGVN
GIPCGESCVWIPCLTSAVGCSCKSKVCY
RN
SLDN
Class Cyclotide
Average Mass 21975.63
Monoisotopic Mass 21961.13
m/z M+H 0
ProteinType Precursor
Parent
Organism Viola biflora
Notes
Cyclic No

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Domains cycloviolacin O9 (34)
cycloviolacin O9 (34)
Nucleic acids Vbc5 mRNA, partial cds
Structure
Links GenBank ABW08094.1

Tools