Vbc4 precursor protein (partial)(421) Protein Card

General Information
Name Vbc4 precursor protein (partial)
Sequence
AAFALPAFAS
FEKDVITPSVLEAVLNRKAPLSNIMMENDA
ILNVIANVKTVISN
PVLEEALLKTNHGVN
GIPCGESCVWI
PCLTSAVGCPCKSKVCYRN
SLDN
Class Cyclotide
Average Mass 10974.82
Monoisotopic Mass 10967.59
m/z M+H 10968.6
ProteinType Precursor
Parent
Organism Viola biflora
Notes
Cyclic No

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Domains vibi K (362)
Nucleic acids Vbc4 mRNA, partial cds
Structure
Links GenBank ABW08093.1

Tools