Vbc3 precursor protein (partial)(420) Protein Card

General Information
Name Vbc3 precursor protein (partial)
Sequence
AAFALPALAT
SFEKDFITHETVQEILKKVGSNSNGMLDEQ
TISALTGKTIISN
PLLEEALFKSSNSINALG
GTFPCGESC
VWIPCISKVIGCACKSKVCYKN
SLAAAFALPALATSFEKD
FITHETVQEILKKVGSNSNGMLDEQTISALTGKTIISN
PL
LEEALFKSSNSINALG
GTFPCGESCVWIPCISKVIGCACK
SKVCYKN
SLA
Class Cyclotide
Average Mass 22213.74
Monoisotopic Mass 22199.24
m/z M+H 22200.25
ProteinType Precursor
Parent
Organism Viola biflora
Notes
Cyclic No

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Domains vibi J (361)
vibi J (361)
Nucleic acids Vbc3 mRNA, partial cds
Structure
Links GenBank ABW08092.1

Tools