Vbc2 precursor protein (partial)(419) Protein Card

General Information
Name Vbc2 precursor protein (partial)
Sequence
AAFALPAFAS
FEKDVITPAALEAVLNRKAPLSNIMMENDA
ILNVIANVKTVISN
PVLEEALLKTNHGVN
GIPCGESCVWI
PCLTSTVGCSCKSKVCYRN
SLDN
Class Cyclotide
Average Mass 10950.75
Monoisotopic Mass 10943.56
m/z M+H 10944.56
ProteinType Precursor
Parent
Organism Viola biflora
Notes
Cyclic No

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Domains vibi I (360)
Nucleic acids Vbc2 mRNA, partial cds
Structure
Links GenBank ABW08091.1

Tools