Mra30(417) Protein Card

General Information
Name Mra30
Alternative name(s) mram 14
Sequence GSIPCGEGCVFIPCISSIVGCSCKSKVCYKN
Class Cyclotide
Technique PcR
Average Mass 3158.75
Monoisotopic Mass 3156.4
m/z M+H 3158.75
ProteinType Wild type
Parent
Organism Melicytus ramiflorus
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Protein precursor(s) Mra30 precursor protein (partial)
Nucleic acids Mra30 mRNA, partial cds
Structure
Links SwissProt A9P3S0-1

3D models Download or view with Jmol

Tools