Mra30 precursor protein (partial)(416) Protein Card

General Information
Name Mra30 precursor protein (partial)
Sequence
LAL
FERDVITRETVEAVLKKTNPNSNTMLQEDAINALTGK
TLISQ
TILEEALLKNGVVG
GSIPCGEGCVFIPCISSIVGC
SCKSKVCYKN
SLALPTLEKDVITPAALEAVLKSNGGAIVN
TKTIISN
AIFEETLLNNANHVVG
GIPCGESCVFIPCLTSA
IGCSCKSKVCYRN
SLAAN
Class Cyclotide
Technique PcR
Average Mass 18636.72
Monoisotopic Mass 18624.57
m/z M+H 18625.58
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic No

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra30 (400)
Mra30 (417)
Nucleic acids Mra30 mRNA, partial cds
Structure
Links GenBank ABO21628.1

Tools