Mra25 precursor protein (partial)(410) Protein Card

General Information
Name Mra25 precursor protein (partial)
Sequence
FAA
YEIKDVISRNAVEGVLKKRVGFLSEEAINELAQGKTI
ISN
PVLEEALVMYAKSKGLG
GSAILCGESCTLGECYTPGC
TCSWPICTKN
SLDA
Class Cyclotide
Technique PcR
Average Mass 9976.52
Monoisotopic Mass 9969.99
m/z M+H 9971
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic No

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra25 (411)
Nucleic acids Mra25 mRNA, partial cds
Structure
Links GenBank ABO21621.1

Tools