Mra23(407) Protein Card

General Information
Name Mra23
Alternative name(s) globa G,mram 10
Sequence GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
Class Cyclotide
Technique PcR
Average Mass 3255.87
Monoisotopic Mass 3253.47
m/z M+H 3255.87
ProteinType Wild type
Parent
Organism Melicytus ramiflorus
Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic Yes

Assay
No assays found

References
Trabi M, Craik DJ (2004) Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1. Plant Cell 16:2204-16
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Protein precursor(s) Mra23 precursor protein (partial)
Gbc6 precursor
mram 10 precursor (partial)
mram 10 precursor (partial)
Nucleic acids Mra23 mRNA, partial cds
Structure
Links SwissProt A9P3R6

3D models Download or view with Jmol

Tools