Mra22 precursor protein (partial)(404) Protein Card

General Information
Name Mra22 precursor protein (partial)
Sequence
LAT
FERDVITPETVHAILKKTNSNSNIMLHEDAIQALTGK
TLISK
TVLEEALLKNAENGLVGS
GVPCGESCVWIPCLTSI
VGCSCKNNVCTLN
SLAQN
Class Cyclotide
Average Mass 10380.98
Monoisotopic Mass 10374.26
m/z M+H 10375.27
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic Yes

Assay
No assays found

References
Trabi M, Craik DJ (2004) Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1. Plant Cell 16:2204-16

Cross-references
Domains Mra22 (405)
Nucleic acids Mra22 mRNA, partial cds
Structure
Links GenBank ABO21623.1

Tools