Mra30(400) Protein Card

General Information
Name Mra30
Alternative name(s) mram 8,Mra18b
Sequence GIPCGESCVFIPCLTSAIGCSCKSKVCYRN
Class Cyclotide
Technique MS,PcR
Average Mass 3115.68
Monoisotopic Mass 3113.37
m/z M+H 3115.68
ProteinType Wild type
Parent
Organism Viola tricolor
Melicytus ramiflorus
Viola philippica
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388
He,W., Chan,L.Y., Zeng,G., Daly,N.L., Craik,D.J. and Tan,N. (2011) Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides 32:1719-1723
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Protein precursor(s) Mra18 precursor protein (partial)
Mra19 precursor protein (partial)
Mra28 precursor protein (partial)
Mra29 precursor protein (partial)
Mra30 precursor protein (partial)
Nucleic acids Mra19 mRNA, partial cds
Mra18 mRNA, partial cds
Mra28 mRNA, partial cds
Mra29 mRNA, partial cds
Mra30 mRNA, partial cds
Structure
Links SwissProt A9P3S0-2

3D models Download or view with Jmol

Tools