Mra29(399) Protein Card

General Information
Name Mra29
Alternative name(s) mram 7,Mra18a
Sequence GSIPCGESCVFIPCISSIVGCSCKSKVCYKN
Class Cyclotide
Technique PcR
Average Mass 3188.77
Monoisotopic Mass 3186.41
m/z M+H 3188.77
ProteinType Wild type
Parent
Organism Melicytus ramiflorus
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Protein precursor(s) Mra18 precursor protein (partial)
Mra19 precursor protein (partial)
Mra28 precursor protein (partial)
Mra29 precursor protein (partial)
Nucleic acids Mra19 mRNA, partial cds
Mra18 mRNA, partial cds
Mra28 mRNA, partial cds
Mra29 mRNA, partial cds
Structure
Links SwissProt A9P3R9-1

3D models Download or view with Jmol

Tools