Mra18 precursor protein (partial)(398) Protein Card

General Information
Name Mra18 precursor protein (partial)
Sequence
LAF
FERDVITRETIEAVLKKINPNSNTMLQDDAINALTGK
TLISQ
TILEEALLKNGVVG
GSIPCGESCVFIPCISSIVGC
SCKSKVCYKN
SLALPTLEKDVITPAALEAVLKSNGGAIVN
SKTIISN
AIFEETFLNNANHVVG
GIPCGESCVFIPCLTSA
IGCSCKSKVCYRN
SLAAN
Class Cyclotide
Technique PcR
Average Mass 18732.81
Monoisotopic Mass 18720.57
m/z M+H 18721.58
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic No

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra30 (400)
Mra29 (399)
Nucleic acids Mra18 mRNA, partial cds
Structure
Links GenBank ABO21620.1

Tools