Mra17 precursor protein (partial)(396) Protein Card

General Information
Name Mra17 precursor protein (partial)
Sequence
LAF
FERDVITPETIEAVLKKTNPSSNIMLQEDAINALTSK
TLISQ
TILEEALLKNGVVG
GSIPCGESCVYIPCISSLLGC
SCESKVCYKN
SLALPTLEKDVITPEALEAVLKSNGGAIVN
TKTIISN
AIFEETLLNNANHVVG
G
Class Cyclotide
Technique PcR
Average Mass 15238.60
Monoisotopic Mass 15228.9
m/z M+H 15229.91
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic No

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra17 (397)
Nucleic acids Mra17 mRNA, partial cds
Structure
Links GenBank ABO21618.1

Tools