Mra15 precursor protein (partial)(395) Protein Card

General Information
Name Mra15 precursor protein (partial)
Sequence
LAF
FERDVITPETIEAVLKKTNPSSNIVLQEDAINALTGK
TLISQ
TILEEALLKNGVVG
GSIPCGESCVYIPCISSLLGC
SCKSKVCYKN
SLALPTLEKDVITPEALEAVLKSNGGAIVN
TKTIISNAIFEETLLNNADHVVGG
Class Cyclotide
Technique PcR
Average Mass 15158.54
Monoisotopic Mass 15148.94
m/z M+H 15149.94
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra4 (388)
Nucleic acids Mra16 mRNA, partial cds
Structure
Links GenBank ABO21617.1

Tools