Mra14 precursor protein (partial)(394) Protein Card

General Information
Name Mra14 precursor protein (partial)
Sequence
LAI
FERDVITPETIEAVLKKTNPNSNIMLQEDAINALTGK
TLISK
TILEEAFLKNGVVG
GSIPCGESCVFIPCISSVVGC
SCKNKVCYKN
SLALPTLEKDVITPEALEAVLKSNGGAIVN
IKTIVSN
TIFEEALPNNANHGLG
GTIPCGESCVFIPCLTS
AIGCSCKSKVCYKN
SLALN
Class Cyclotide
Technique PcR
Average Mass 18807.95
Monoisotopic Mass 18795.65
m/z M+H 18796.66
ProteinType Precursor
Parent
Organism Melicytus ramiflorus
Notes
Cyclic No

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Domains Mra14b (393)
Mra14a (392)
Nucleic acids Mra14 mRNA, partial cds
Structure
Links GenBank ABO21616.1

Tools