Mra14b(393) Protein Card

General Information
Name Mra14b
Alternative name(s) mram 5
Sequence GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN
Class Cyclotide
Technique PcR
Average Mass 3188.77
Monoisotopic Mass 3186.41
m/z M+H 3188.77
ProteinType Wild type
Parent
Organism Melicytus ramiflorus
Notes
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Protein precursor(s) Mra14 precursor protein (partial)
Mra20 precursor protein (partial)
Mra21 precursor protein (partial)
Nucleic acids Mra20 mRNA, partial cds
Mra21 mRNA, partial cds
Mra14 mRNA, partial cds
Structure
Links SwissProt A9P3Q8-2

3D models Download or view with Jmol

Tools