Mra14a(392) Protein Card

General Information
Name Mra14a
Alternative name(s) mram 4
Sequence GSIPCGESCVFIPCISSVVGCSCKNKVCYKN
Class Cyclotide
Technique PcR
Average Mass 3201.77
Monoisotopic Mass 3199.41
m/z M+H 3201.77
ProteinType Wild type
Parent
Organism Melicytus ramiflorus
Notes predicted from precursor
Cyclic Yes

Assay
No assays found

References
Trabi M, Mylne JS, Bharathi R, Sando L and Craik DJ (2009) Circular proteins from Melicytus (Violaceae) refine the conserved protein and gene architecture of cyclotides. Org Biomol Chem 7:2378-2388

Cross-references
Protein precursor(s) Mra14 precursor protein (partial)
Nucleic acids Mra14 mRNA, partial cds
Structure
Links SwissProt A9P3Q8-1

3D models Download or view with Jmol

Tools