Hyfl F precursor protein (partial)(382) Protein Card

General Information
Name Hyfl F precursor protein (partial)
Sequence
SISCGETCTTFNCWIPNCKCNHHDKVCYWN
SLDEN
Class Cyclotide
Average Mass 4066.52
Monoisotopic Mass 4063.66
m/z M+H 4064.67
ProteinType Precursor
Parent
Organism Hybanthus floribundus E
Notes
Cyclic No

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Domains Hyfl F (146)
Nucleic acids Hyfl F (partial)
Structure
Links GenBank ABB51618.1

Tools