Viba 2(375) Protein Card

General Information
Name Viba 2
Alternative name(s) cycloviolacin B1
Sequence GIPCGESCVYLPCFTAPLGCSCSSKVCYRN
Class Cyclotide
Average Mass 3134.64
Monoisotopic Mass 3132.31
m/z M+H 3133.32
ProteinType Wild type
Parent
Organism Viola baoshanensis
Notes predicted from Viola baoshanensis precursor
Cyclic Yes

Assay
No assays found

References
Zhang J, Liao B, Craik DJ, Li J-T, Hu M, Shu W (2009) Identification of two suites of cyclotide precursor genes from metallophyte Viola baoshanensis: cDNA sequence variation, alternative RNA splicing and potential cyclotide diversity Gene 431:23-32

Cross-references
Protein precursor(s) Viola baoshanensis cyclotide precursor 1
cyclotide precursor 1b
Nucleic acids Viola baoshanensis cyclotide precursor 1 mRNA
cyclotide precursor 1b mRNA
Structure
Links SwissProt Q09PG2

3D models Download or view with Jmol

Tools