Hyfl P precursor (partial)(369) Protein Card

General Information
Name Hyfl P precursor (partial)
Sequence
AAFALPA
IATLEKDVITPKAIELILKKTNTPLSNIMLQDD
ALVNALVKSKTMISN
TVFEEALLKHSNHGLG
GSVPCGESC
VWIPCISGIAGCSCKNKVCYLN
SLDN
Class Cyclotide
Average Mass 11230.17
Monoisotopic Mass 11222.8
m/z M+H 11223.8
ProteinType Precursor
Parent
Organism Hybanthus floribundus W
Notes
Cyclic No

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Domains Hyfl P (156)
Nucleic acids Hyfl P (partial)
Structure
Links GenBank ABB04003.1

Tools