Hyfl M precursor (partial)(366) Protein Card

General Information
Name Hyfl M precursor (partial)
Sequence
AAFALPALAS
FEKDVITPRGIELMLKKTNFPLSNIMLEED
TMSALVKTKTLISD
TVFDALLKNSHTNG
GNIPCGESCIFF
PCFNPGCSCKDNLCYYN
SLVGN
Class Cyclotide
Average Mass 11085.84
Monoisotopic Mass 11078.44
m/z M+H 11079.45
ProteinType Precursor
Parent
Organism Hybanthus floribundus W
Notes
Cyclic No

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Domains Hyfl M (153)
Nucleic acids Hyfl M (partial)
Structure
Links GenBank ABB04000.1

Tools