Hyfl L precursor (partial)(365) Protein Card

General Information
Name Hyfl L precursor (partial)
Sequence
AAFALPAIAT
LEKDVITPKAIELILKKTNSPLSNIMLQED
ALLNSLVKTKTMISN
TVFEEALLKHSHHGLG
GTPCAESCV
YLPCFTGVIGCTCKDKVCYLN
SLDN
Class Cyclotide
Average Mass 11294.26
Monoisotopic Mass 11286.82
m/z M+H 11287.82
ProteinType Precursor
Parent
Organism Hybanthus floribundus W
Notes
Cyclic No

Assay
No assays found

References
Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Goransson U, Craik DJ (2005) A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae). Plant Cell 17:3176-89

Cross-references
Domains Hyfl L (152)
Nucleic acids Hyfl L (partial)
Structure
Links GenBank ABB03999.1

Tools