vibi F(357) Protein Card

General Information
Name vibi F
Sequence GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
Class Cyclotide
Average Mass 3188.77
Monoisotopic Mass 3186.41
m/z M+H 3187.42
ProteinType Wild type
Parent
Organism Viola biflora
Notes
Cyclic Yes

Assay
No assays found

References
Herrmann A, Burman R, Mylne JS, Karlsson G, Gullbo J, Craik DJ, Clark RJ, Goransson U (2008) The alpine violet, Viola biflora, is a rich source of cyclotides with potent cytotoxicity Phytochemistry 69:939-952

Cross-references
Nucleic acids
Structure
Links SwissProt P85244

3D models Download or view with Jmol

Tools