cycloviolacin Y5(351) Protein Card

General Information
Name cycloviolacin Y5
Sequence GIPCAESCVWIPCTVTALVGCSCSDKVCYN
Class Cyclotide
Average Mass 3098.60
Monoisotopic Mass 3096.3
m/z M+H 3097.31
ProteinType Wild type
Parent
Organism Viola baoshanensis
Viola yedoensis
Notes
Cyclic Yes

Assay
Hemolytic
Cycloviolacins Y4 and Y5 are the most hemolytic of the new cyclotides, both being more potent than the prototypic cyclotide kalata B1. By contrast, cycloviolacin Y1 is substantially less active than all of the other cyclotides tested. [...]Wang CK et al. (2007) J Nat Prod 71:47-52
Anti-HIV
All cyclotides tested from V. yedoensis demonstrated anti-HIV activity, with cycloviolacin Y5 being the most potent. [...]Wang CK et al. (2007) J Nat Prod 71:47-52
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945

References
Wang CK, Colgrave ML, Gustafson KR, Ireland DC, Göransson U, Craik DJ (2007) Anti-HIV Cyclotides from the CHinese Medicinal Herb Viola yedoensis J Nat Prod 71:47-52

Cross-references
Protein precursor(s) cyclotide precursor 4b
Nucleic acids cyclotide precursor 4b mRNA
Structure
Links SwissProt B5B3Z0

3D models Download or view with Jmol

Tools