vico A(35) Protein Card

General Information
Name vico A
Sequence GSIPCAESCVYIPCFTGIAGCSCKNKVCYYN
Class Cyclotide
Average Mass 3270.79
Monoisotopic Mass 3268.36
m/z M+H 3269.37
ProteinType Wild type
Parent
Organism Viola cotyledon
Notes
Cyclic Yes

Assay
No assays found

References
Trabi M, Craik DJ (2004) Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1. Plant Cell 16:2204-16
Goransson U, Broussalis AM, Claeson P (2003) Expression of Viola cyclotides by liquid chromatography-mass spectrometry and tandem mass spectrometry sequencing of intercysteine loops after introduction of charges and cleavage sites by aminoethylation. Anal Biochem 318:107-117

Cross-references
Nucleic acids
Structure
Links GenBank P84635.1
SwissProt P84635

3D models Download or view with Jmol

Tools