CD-1(346) Protein Card

General Information
Name CD-1
Sequence GADGFCGESCYVIPCISYLVGCSCDTIEKVCKRN
Class Cyclotide
Technique Amino acid analysis,MS
Average Mass 3610.14
Monoisotopic Mass 3607.54
m/z M+H 3610.14
ProteinType Wild type
Parent
Organism Chassalia discolor
Notes
Cyclic Yes

Assay
No assays found

References
Gruber CW, Elliott AG, Ireland DC, Delprete PG, Dessein S, Göransson U, Trabi M, Wang CK, Kinghorn AB, Robbrecht E, Craik DJ (2008) Distribution and evolution of circular miniproteins in flowering plants. Plant Cell 20:2471-2483

Cross-references
Nucleic acids
Structure
Links

3D models Download or view with Jmol

Tools