cyclopsychotride A(32) Protein Card

General Information
Name cyclopsychotride A
Sequence SIPCGESCVFIPCTVTALLGCSCKSKVCYKN
Class Cyclotide
Average Mass 3230.85
Monoisotopic Mass 3228.46
m/z M+H 3229.47
ProteinType Wild type
Parent
Organism Psychotria longipes
Notes
Cyclic Yes

Assay
Neurotensin Inhibition
Inhibited [125I] Neurotensin binding to HT-29 cell membranes (IC50 3 uM), and increased levels of cytosolic Ca2+ in two unrelated cell lines that do not express NT receptors [...]Witherup KM et al. (1994) J Nat Prod 57:1619-25
Hemolytic
Hemolytic activity established for kalata B1, circulin A, circulin B and cyclopsychotride A [...]Tam JP et al. (1999) Proc Natl Acad Sci U S A 96:8913-8

References
Tam JP, Lu YA, Yang JL, Chiu KW (1999) An unusual structural motif of antimicrobial peptides containing end-to-end macrocycle and cystine-knot disulfides. Proc Natl Acad Sci U S A 96:8913-8
Tam JP, Lu YA (1998) A biomimetic strategy in the synthesis and fragmentation of cyclic protein. Protein Sci 7:1583-92
Witherup KM, Bogusky MJ, Anderson PS, Ramjit H, Ransom RW, Wood T, Sardana M (1994) Cyclopsychotride A, a biologically active, 31-residue cyclic peptide isolated from Psychotria longipes. J Nat Prod 57:1619-25

Cross-references
Nucleic acids
Structure
Links GenBank P56872.2
SwissProt P56872

3D models Download or view with Jmol

Tools