MC 3(266) Protein Card

General Information
Name MC 3
Sequence CGETCVGGTCNTPGCTCSWPVCYRSPFSRVVH
Class Cyclotide
Average Mass 3383.83
Monoisotopic Mass 3381.37
m/z M+H 3383.83
ProteinType Grafted
Parent kalata B1
Organism Synthetic
Notes Studied by Sunithi Gunasekera
Cyclic Yes

Assay
No assays found

References

Cross-references
Nucleic acids
Structure
Links

Tools