kalata B16(254) Protein Card

General Information
Name kalata B16
Sequence GIPCAESCVYIPCTITALLGCKCQDKVCYD
Class Cyclotide
Technique NGS,Amino acid analysis
Average Mass 3186.75
Monoisotopic Mass 3184.39
m/z M+H 3186.75
ProteinType Wild type
Parent
Organism Oldenlandia affinis
Notes
Cyclic Yes

Assay
No assays found

References
Plan MR, Goransson U, Clark RJ, Daly NL, Colgrave ML, Craik DJ (2007) The Cyclotide Fingerprint in Oldenlandia affinis: Elucidation of Chemically Modified, Linear and Novel Macrocyclic Peptides Chembiochem 8:1001-1011

Cross-references
Nucleic acids
Structure
Links SwissProt P85134

3D models Download or view with Jmol

Tools