kalata B9 linear(245) Protein Card

General Information
Name kalata B9 linear
Sequence GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
Class Cyclotide
Average Mass 3290.70
Monoisotopic Mass 3288.32
m/z M+H 3289.33
ProteinType Wild type
Parent
Organism Oldenlandia affinis
Notes linear
Cyclic No

Assay
No assays found

References

Cross-references
Nucleic acids
Structure
Links

Tools