kalata B9 linear(245) Protein Card

General Information
Name kalata B9 linear
Sequence GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
Class Cyclotide
Average Mass 3290.70
Monoisotopic Mass 3288.32
m/z M+H 3290.7
ProteinType Wild type
Parent
Organism Oldenlandia affinis
Notes linear
Cyclic No

Assay
No assays found

References
Plan MR, Goransson U, Clark RJ, Daly NL, Colgrave ML, Craik DJ (2007) The Cyclotide Fingerprint in Oldenlandia affinis: Elucidation of Chemically Modified, Linear and Novel Macrocyclic Peptides Chembiochem 8:1001-1011

Cross-references
Nucleic acids
Structure
Links

Tools